IQCF1 antibody (Middle Region)

Catalog No. ABIN635588

Product Details anti-IQCF1 Antibody

Target: IQCF1 (IQ Motif Containing F1 (IQCF1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IQCF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IQCF1 antibody was raised against the middle region of IQCF1

Purification: Affinity purified

Immunogen: IQCF1 antibody was raised using the middle region of IQCF1 corresponding to a region with amino acids ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IQCF1 Blocking Peptide, catalog no. 33R-1560, is also available for use as a blocking control in assays to test for specificity of this IQCF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IQCF1

Target: IQCF1 (IQ Motif Containing F1 (IQCF1))

Alternative Name: IQCF1 (IQCF1 Products)

Synonyms: 1700055J15Rik antibody, IQ motif containing F1 antibody, IQCF1 antibody, Iqcf1 antibody

Background: The exact function of IQCF1 is not known.

Molecular Weight: 24 kDa (MW of target protein)