COX3 antibody (C-Term)

Catalog No. ABIN635599

Product Details anti-COX3 Antibody

Target: COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COX3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COX3 antibody was raised against the C terminal of COX3

Purification: Affinity purified

Immunogen: COX3 antibody was raised using the C terminal of COX3 corresponding to a region with amino acids FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COX3 Blocking Peptide, catalog no. 33R-2880, is also available for use as a blocking control in assays to test for specificity of this COX3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COX3

Target: COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))

Alternative Name: COX3 (COX-3 Products)

Synonyms: COIII antibody, MTCO3 antibody, cytochrome c oxidase III antibody, cytochrome c oxidase subunit III antibody, cytochrome c oxidase subunit 3 antibody, cytochrome oxidasesubunit 3 antibody, COX3 antibody, cox3 antibody

Background: COX3 is a multi-pass membrane protein. It belongs to the cytochrome c oxidase subunit 3 family. Defects in COX3 are a cause of Leber hereditary optic neuropathy (LHON) and cytochrome c oxidase deficiency (COX deficiency). Defects in MT-CO3 are also found in mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS) syndrome and recurrent myoglobinuria.

Molecular Weight: 29 kDa (MW of target protein)