MT-ND5 antibody

Catalog No. ABIN635600

Product Details anti-MT-ND5 Antibody

Target: MT-ND5 (Mitochondrially Encoded NADH Dehydrogenase 5 (MT-ND5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MT-ND5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ND5 Blocking Peptide, catalog no. 33R-8541, is also available for use as a blocking control in assays to test for specificity of this ND5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ND5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MT-ND5

Target: MT-ND5 (Mitochondrially Encoded NADH Dehydrogenase 5 (MT-ND5))

Alternative Name: ND5 (MT-ND5 Products)

Synonyms: MTND5 antibody, NADH5 antibody, NADH dehydrogenase, subunit 5 (complex I) antibody, NADH dehydrogenase subunit 5 antibody, NADH dehydrogenasesubunit 5 antibody, mitochondrial NADH-ubiquinone oxidoreductase chain 5 antibody, ND5 antibody, nad5 antibody, mt:ND5 antibody

Background: ND5 is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Molecular Weight: 66 kDa (MW of target protein)