TMEM117 antibody (Middle Region)

Catalog No. ABIN635605

Product Details anti-TMEM117 Antibody

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM117 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM117 antibody was raised against the middle region of TMEM117

Purification: Affinity purified

Immunogen: TMEM117 antibody was raised using the middle region of TMEM117 corresponding to a region with amino acids GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM117 Blocking Peptide, catalog no. 33R-3520, is also available for use as a blocking control in assays to test for specificity of this TMEM117 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM117 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM117

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Alternative Name: TMEM117 (TMEM117 Products)

Synonyms: wu:fi32b02 antibody, zgc:55574 antibody, MGC154839 antibody, B930062P21Rik antibody, RGD1562562 antibody, transmembrane protein 117 antibody, transmembrane protein 117 S homeolog antibody, tmem117 antibody, TMEM117 antibody, tmem117.S antibody, LOC100472537 antibody, Tmem117 antibody

Background: TMEM117 is a multi-pass membrane protein. It belongs to the TMEM117 family. The exact function of TMEM117 remains unknown.

Molecular Weight: 45 kDa (MW of target protein)