SERINC2 antibody (N-Term)

Catalog No. ABIN635607

Product Details anti-SERINC2 Antibody

Target: SERINC2 (serine Incorporator 2 (SERINC2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERINC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SERINC2 antibody was raised against the N terminal of SERINC2

Purification: Affinity purified

Immunogen: SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERINC2 Blocking Peptide, catalog no. 33R-9449, is also available for use as a blocking control in assays to test for specificity of this SERINC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERINC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERINC2

Target: SERINC2 (serine Incorporator 2 (SERINC2))

Alternative Name: SERINC2 (SERINC2 Products)

Synonyms: 2310004K20Rik antibody, AW121759 antibody, FKSG84 antibody, TDE2 antibody, Tde2l antibody, PRO0899 antibody, TDE2L antibody, serine incorporator 2 antibody, Serinc2 antibody, SERINC2 antibody

Background: The function of SERINC2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)