ZDHHC18 antibody (Middle Region)

Catalog No. ABIN635634

Product Details anti-ZDHHC18 Antibody

Target: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZDHHC18 antibody was raised against the middle region of ZDHHC18

Purification: Affinity purified

Immunogen: ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC18 Blocking Peptide, catalog no. 33R-3066, is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC18

Target: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Alternative Name: ZDHHC18 (ZDHHC18 Products)

Synonyms: fi45c03 antibody, wu:fi45c03 antibody, wu:fj48h10 antibody, zgc:55843 antibody, zdhhc18 antibody, zgc:153461 antibody, DHHC-18 antibody, DHHC18 antibody, zinc finger, DHHC-type containing 18b antibody, zinc finger, DHHC-type containing 18a antibody, zinc finger DHHC-type containing 18 antibody, zinc finger, DHHC domain containing 18 antibody, zinc finger, DHHC-type containing 18 antibody, zdhhc18b antibody, zdhhc18a antibody, ZDHHC18 antibody, Zdhhc18 antibody

Background: ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.

Molecular Weight: 42 kDa (MW of target protein)