ATP5G2 antibody
-
- Target See all ATP5G2 Antibodies
- ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP5G2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ATP5 G2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA
- Top Product
- Discover our top product ATP5G2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP5G2 Blocking Peptide, catalog no. 33R-8767, is also available for use as a blocking control in assays to test for specificity of this ATP5G2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))
- Alternative Name
- ATP5G2 (ATP5G2 Products)
- Synonyms
- GB16842 antibody, 1810041M08Rik antibody, ATP5A antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) antibody, ATP synthase, H+ transporting, mitochondrial Fo complex subunit C2 (subunit 9) antibody, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) antibody, ATP5G2 antibody, Atp5g2 antibody
- Background
- ATP5G2 is a subunit of mitochondrial ATP synthase.
- Molecular Weight
- 8 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-