WNT1 antibody (Middle Region)

Catalog No. ABIN635697

Product Details anti-WNT1 Antibody

Target: WNT1 (Wingless-Type MMTV Integration Site Family, Member 1 (WNT1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNT1 antibody was raised against the middle region of WNT1

Purification: Affinity purified

Immunogen: WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT1 Blocking Peptide, catalog no. 33R-2912, is also available for use as a blocking control in assays to test for specificity of this WNT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT1

Target: WNT1 (Wingless-Type MMTV Integration Site Family, Member 1 (WNT1))

Alternative Name: WNT1 (WNT1 Products)

Synonyms: Xint-1 antibody, Xwnt1 antibody, int-1 antibody, int1 antibody, wnt-1 antibody, wnt1-a antibody, Int-1 antibody, Wnt-1 antibody, sw antibody, swaying antibody, BMND16 antibody, INT1 antibody, OI15 antibody, Int1 antibody, WNT-1 antibody, sb:eu647 antibody, zgc:194464 antibody, zgc:194478 antibody, WNT1 antibody, Wnt family member 1 antibody, Wnt family member 1 L homeolog antibody, wingless-type MMTV integration site family, member 1 antibody, WNT1 antibody, wnt1.L antibody, Wnt1 antibody, wnt1 antibody

Background: WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: WNT Signaling, Dopaminergic Neurogenesis