MTCH1 antibody

Catalog No. ABIN635711

The Rabbit Polyclonal anti-MTCH1 antibody has been validated for WB. It is suitable to detect MTCH1 in samples from Human, Mouse and Rat.

Quick Overview for MTCH1 antibody (ABIN635711)

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTCH1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTCH1 Antibody

Purification: Affinity purified

Immunogen: MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTCH1 Blocking Peptide, (ABIN5614860), is also available for use as a blocking control in assays to test for specificity of this MTCH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTCH1

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Alternative Name: MTCH1

Background: MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, SARS-CoV-2 Protein Interactome