WNT6 antibody (Middle Region)

Catalog No. ABIN635755

Product Details anti-WNT6 Antibody

Target: WNT6 (Wingless-Type MMTV Integration Site Family, Member 6 (WNT6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNT6 antibody was raised against the middle region of WNT6

Purification: Affinity purified

Immunogen: WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT6 Blocking Peptide, catalog no. 33R-2692, is also available for use as a blocking control in assays to test for specificity of this WNT6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT6

Target: WNT6 (Wingless-Type MMTV Integration Site Family, Member 6 (WNT6))

Alternative Name: WNT6 (WNT6 Products)

Synonyms: WNT6 antibody, si:dkey-31m21.2 antibody, Wnt6 antibody, AA409270 antibody, Wnt-6 antibody, Xwnt-6 antibody, wnt-6 antibody, wnt6-A antibody, xWnt6 antibody, Wnt family member 6 antibody, wingless-type MMTV integration site family, member 6b antibody, wingless-type MMTV integration site family, member 6 antibody, Wnt family member 6 S homeolog antibody, WNT6 antibody, Wnt6 antibody, wnt6b antibody, wnt6.S antibody

Background: The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: WNT Signaling, Tube Formation