GZMK antibody
-
- Target See all GZMK Antibodies
- GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GZMK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK
- Top Product
- Discover our top product GZMK Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Granzyme K Blocking Peptide, catalog no. 33R-7402, is also available for use as a blocking control in assays to test for specificity of this Granzyme K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))
- Alternative Name
- Granzyme K (GZMK Products)
- Synonyms
- TRYP2 antibody, granzyme K antibody, GZMK antibody, Gzmk antibody
- Background
- GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.
- Molecular Weight
- 26 kDa (MW of target protein)
-