FZD5 antibody

Catalog No. ABIN635844

Product Details anti-FZD5 Antibody

Target: FZD5 (Frizzled Family Receptor 5 (FZD5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FZD5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD5 Blocking Peptide, catalog no. 33R-8742, is also available for use as a blocking control in assays to test for specificity of this FZD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD5

Target: FZD5 (Frizzled Family Receptor 5 (FZD5))

Alternative Name: FZD5 (FZD5 Products)

Synonyms: C2orf31 antibody, HFZ5 antibody, 5330434N09Rik antibody, AI427138 antibody, Fz-5 antibody, Fz5 antibody, mFz5 antibody, Xfz5 antibody, frizzled5 antibody, frizzled5a antibody, fz5 antibody, fzd5-A antibody, fz2 antibody, fz8c antibody, fzd8c antibody, zg02 antibody, frizzled class receptor 5 antibody, frizzled class receptor 5 S homeolog antibody, FZD5 antibody, Fzd5 antibody, fzd5.S antibody, fzd5 antibody

Background: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: WNT Signaling