GZMK antibody

Catalog No. ABIN635952

Product Details anti-GZMK Antibody

Target: GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GZMK antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Granzyme K Blocking Peptide, catalog no. 33R-5391, is also available for use as a blocking control in assays to test for specificity of this Granzyme K antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GZMK

Target: GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))

Alternative Name: Granzyme K (GZMK Products)

Synonyms: TRYP2 antibody, granzyme K antibody, GZMK antibody, Gzmk antibody

Background: GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells.

Molecular Weight: 26 kDa (MW of target protein)