TMTC2 antibody (N-Term)

Catalog No. ABIN635998

Product Details anti-TMTC2 Antibody

Target: TMTC2 (Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMTC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMTC2 antibody was raised against the N terminal of TMTC2

Purification: Affinity purified

Immunogen: TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMTC2 Blocking Peptide, catalog no. 33R-8658, is also available for use as a blocking control in assays to test for specificity of this TMTC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMTC2

Target: TMTC2 (Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2))

Alternative Name: TMTC2 (TMTC2 Products)

Synonyms: si:ch211-161n3.1 antibody, IBDBP1 antibody, 8430438D04Rik antibody, D330034A10Rik antibody, RGD1309848 antibody, transmembrane and tetratricopeptide repeat containing 2a antibody, transmembrane and tetratricopeptide repeat containing 2 S homeolog antibody, transmembrane and tetratricopeptide repeat containing 2 antibody, tmtc2a antibody, tmtc2.S antibody, TMTC2 antibody, Tmtc2 antibody

Background: TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.

Molecular Weight: 94 kDa (MW of target protein)