C1GALT1 antibody (Middle Region)
-
- Target See all C1GALT1 Antibodies
- C1GALT1 (Core 1 Synthase, Glycoprotein-N-Acetylgalactosamine 3-beta-Galactosyltransferase, 1 (C1GALT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1GALT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 GALT1 antibody was raised against the middle region of C1 ALT1
- Purification
- Affinity purified
- Immunogen
- C1 GALT1 antibody was raised using the middle region of C1 ALT1 corresponding to a region with amino acids NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
- Top Product
- Discover our top product C1GALT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1GALT1 Blocking Peptide, catalog no. 33R-6911, is also available for use as a blocking control in assays to test for specificity of this C1GALT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 ALT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1GALT1 (Core 1 Synthase, Glycoprotein-N-Acetylgalactosamine 3-beta-Galactosyltransferase, 1 (C1GALT1))
- Alternative Name
- C1GALT1 (C1GALT1 Products)
- Synonyms
- C1GALT antibody, T-synthase antibody, 2210410E06Rik antibody, AV284120 antibody, c1galt1 antibody, fa98f05 antibody, zgc:66485 antibody, wu:fa98f05 antibody, C1GALT1 antibody, C1GalT1-A antibody, Core 1 beta3-Gal-T1-A antibody, wu:fi11c09 antibody, zgc:153355 antibody, core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 antibody, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 L homeolog antibody, core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 antibody, core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1b antibody, core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1a antibody, C1GALT1 antibody, LOC100496837.L antibody, C1galt1 antibody, c1galt1b antibody, c1galt1a antibody
- Background
- The common core 1 O-glycan structure Gal-beta-1-3GalNAc-R is a precursor for many extended mucin-type O-glycan structures in animal cell surface and secreted glycoproteins.
- Molecular Weight
- 42 kDa (MW of target protein)
-