B4GALNT3 antibody (N-Term)

Catalog No. ABIN636034

Product Details anti-B4GALNT3 Antibody

Target: B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B4GALNT3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: B4 GALNT3 antibody was raised against the N terminal of B4 ALNT3

Purification: Affinity purified

Immunogen: B4 GALNT3 antibody was raised using the N terminal of B4 ALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B4GALNT3 Blocking Peptide, catalog no. 33R-6666, is also available for use as a blocking control in assays to test for specificity of this B4GALNT3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B4GALNT3

Target: B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))

Alternative Name: B4GALNT3 (B4GALNT3 Products)

Synonyms: RGD1561056 antibody, AB114826 antibody, B4GalNAcT3 antibody, C330047A21 antibody, beta-1,4-N-acetyl-galactosaminyltransferase 3 antibody, beta-1,4-N-acetyl-galactosaminyl transferase 3 antibody, B4GALNT3 antibody, B4galnt3 antibody

Background: B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa.

Molecular Weight: 115 kDa (MW of target protein)