NFIA antibody (Middle Region)

Catalog No. ABIN6719349

Product Details anti-NFIA Antibody

Target: NFIA (Nuclear Factor I/A (NFIA))

Binding Specificity: AA 180-224, Middle Region

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This NFIA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purpose: Mouse IgG monoclonal antibody for NFIA detection. Tested with Tested with WB, IHC-P, FCM in Human.

Sequence: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SGVFS

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Mouse IgG monoclonal antibody for NFIA detection. Tested with Tested with WB, IHC-P, FCM in Human.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Clone: 16H11

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Alternative Name: NFIA (NFIA Products)

Synonyms: NFIA antibody, CTF antibody, NF-I/A antibody, NF1-A antibody, NFI-A antibody, NFI-L antibody, si:ch211-88d2.2 antibody, wu:fq27e07 antibody, zgc:158351 antibody, CNFI-A antibody, cNFI-A3 antibody, 1110047K16Rik antibody, 9430022M17Rik antibody, NF1A antibody, nuclear factor I A antibody, nuclear factor I/A antibody, NFIA antibody, nfia antibody, Nfia antibody

Background:

Synonyms: Nuclear factor 1 A-type, NF1-A, Nuclear factor 1/A, CCAAT-box-binding transcription factor, CTF, Nuclear factor I/A, NF-I/A, NFI-A, TGGCA-binding protein, NFIA, KIAA1439

Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

Gene ID: 4774

UniProt: Q12857