PPT1 antibody (C-Term)

Catalog No. ABIN6719501

Product Details anti-PPT1 Antibody

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Binding Specificity: AA 191-224, C-Term

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This PPT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purpose: Mouse IgG monoclonal antibody for PPT1 detection. Tested with WB, IHC-P, FCM in Human.

Sequence: KEDVYRNHSI FLADINQERG INESYKKNLM ALKK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Mouse IgG monoclonal antibody for PPT1 detection. Tested with WB, IHC-P, FCM in Human.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.

Clone: 10F3

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PPT1

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Alternative Name: PPT1 (PPT1 Products)

Synonyms: CLN1 antibody, INCL antibody, PPT antibody, 9530043G02Rik antibody, AA960502 antibody, C77813 antibody, D4Ertd184e antibody, Ppt antibody, wu:fj17f04 antibody, zgc:63969 antibody, PPT-1 antibody, ppt1 antibody, palmitoyl-protein thioesterase 1 antibody, Palmitoyl-protein thioesterase 1 antibody, palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) antibody, palmitoyl-protein thioesterase 1 L homeolog antibody, PPT1 antibody, MGYG_00692 antibody, Ppt1 antibody, ppt-1 antibody, ppt1 antibody, ppt1.L antibody

Background:

Synonyms: Palmitoyl-protein thioesterase 1, PPT-1, Palmitoyl-protein hydrolase 1, PPT1, CLN1, PPT

Background: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

Gene ID: 5538

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome