CD68 antibody (AA 27-282)

Catalog No. ABIN7442816

Product Details anti-CD68 Antibody

Target: CD68 (CD68 Molecule (CD68))

Binding Specificity: AA 27-282

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD68 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Purpose: Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1)

Specificity: The antibody is a rabbit polyclonal antibody raised against SCARD1. It has been selected for its ability to recognize SCARD1 in immunohistochemical staining and western blotting.

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogen: Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag

Isotype: IgG

Application Details

Application Notes:

Western blotting: 0.5-2 μg/mL

Immunohistochemistry: 5-20 μg/mL

Immunocytochemistry: 5-20 μg/mL

Optimal working dilutions must be determined by end user.

Comment:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.

Preservative: ProClin

Precaution of Use: This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Expiry Date: 24 months

Target Details for CD68

Target: CD68 (CD68 Molecule (CD68))

Alternative Name: Scavenger Receptor Class D Member 1 (CD68 Products)

Synonyms: Lamp4 antibody, Scard1 antibody, gp110 antibody, GP110 antibody, LAMP4 antibody, SCARD1 antibody, CD68 molecule antibody, CD68 antigen antibody, Cd68 molecule antibody, CD68 antibody, Cd68 antibody

Background: CD68, GP110, Macrosialin, Macrophage Antigen CD68