DLG2 antibody (AA 336-379)

Catalog No. ABIN7043102

Product Details anti-DLG2 Antibody

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Binding Specificity: AA 336-379

Reactivity: Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLG2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunofluorescence (IF), Immunocytochemistry (ICC)

Characteristics: Anti-PSD-93 Antibody (ABIN7043102, ABIN7045142 and ABIN7045143)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize PSD-93 from rat, mouse, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 1 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: RT,4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for DLG2

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Alternative Name: PSD-93 (DLG2 Products)

Synonyms: PPP1R58 antibody, PSD-93 antibody, PSD93 antibody, chapsyn-110 antibody, A330103J02Rik antibody, B230218P12Rik antibody, B330007M19Rik antibody, Dlgh2 antibody, Gm1197 antibody, discs, large homolog 2 (Drosophila) antibody, discs large MAGUK scaffold protein 2 antibody, dlg2 antibody, DLG2 antibody, Dlg2 antibody

Background: Alternative names: PSD-93, Discs large homolog 2, Dlg2, Chapsyn-110

Gene ID: 64053

NCBI Accession: NM_001364

UniProt: Q63622