MAP3K1 antibody (AA 1077-1176)

Catalog No. ABIN7657214

The Mouse Monoclonal anti-MAP3K1 antibody has been validated for IHC and IHC (fp). It is suitable to detect MAP3K1 in samples from Human.

Quick Overview for MAP3K1 antibody (AA 1077-1176) (ABIN7657214)

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This MAP3K1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp))

Clone: 2F6

Product Details anti-MAP3K1 Antibody

Binding Specificity: AA 1077-1176

Purpose: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(2F6)

Characteristics: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Immunogen: Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Isotype: IgG2a, kappa

Application Details

Application Notes: Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody. Immunohistochemistry (formalin-fixed): 1-2 μg/mL for 30 minutes at RT. Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris buffer with 1 mM EDTA pH 9.0 for 10-20 minutes followed by cooling at RT for 20 minutes. Western Blot 0.5-1 μg/mL. Optimal dilution for a specific application should be determined by user

Comment:

Positive Control: A431, HeLa or HL-60 cells. Liver tissue.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.2 mg/mL

Buffer: PBS, 0.05 % BSA, 0.05 % azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C

Storage Comment:

Stable at room temperature or 37°C for 7 days.

Store at 2 to 8°C. Protect fluorescent conjugates from light

Expiry Date: 24 months

Target Details for MAP3K1

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Alternative Name: MAP3K1

Background:

Synonyms: MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1

Gene Symbol: MAP3K1

Molecular Weight: 195 kDa (intact), 80 kDa (cleaved)

Gene ID: 4214

UniProt: Q13233

Pathways: MAPK Signaling, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades