RAGE antibody (AA 91-120)

Catalog No. ABIN7877133

The Mouse Monoclonal anti-RAGE antibody is suitable to detect RAGE in samples from Human, Mouse and Rat. It has been validated for WB, FACS and IHC (p).

Quick Overview for RAGE antibody (AA 91-120) (ABIN7877133)

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This RAGE antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 5C6C1

Product Details anti-RAGE Antibody

Binding Specificity: AA 91-120

Purpose: AGER Antibody / RAGE

Sequence: IQDEGIFRCQ AMNRNGKETK SNYRVRVYQI

Purification: Antigen affinity purified

Immunogen: Amino acids 91-120 (IQDEGIFRCQAMNRNGKETKSNYRVRVYQI) from the human protein were used as the immunogen for the AGER antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the AGER antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the AGER antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for RAGE

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Alternative Name: AGER

Background: The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

UniProt: Q15109

Pathways: Carbohydrate Homeostasis, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, S100 Proteins