RAB11A antibody (C-Term)

Catalog No. ABIN7877466

The Mouse Monoclonal anti-RAB11A antibody is suitable to detect RAB11A in samples from Human, Mouse and Rat. It has been validated for WB, IF, IHC (p) and FACS.

Quick Overview for RAB11A antibody (C-Term) (ABIN7877466)

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This RAB11A antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 4H9

Product Details anti-RAB11A Antibody

Binding Specificity: C-Term

Purpose: RAB11A Antibody

Sequence: EIYRIVSQKQ MSDRRENDMS PSNNVVPIHV PPTTENKPKV Q

Purification: Antigen affinity purified

Immunogen: C-terminal region amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ from the human protein were used as the immunogen for the RAB11A antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the RAB11A antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the RAB11A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for RAB11A

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Alternative Name: RAB11A

Background: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

UniProt: P62491

Pathways: Regulation of Cell Size, Thromboxane A2 Receptor Signaling, Regulation of long-term Neuronal Synaptic Plasticity