HECTD3 antibody

Catalog No. ABIN7880991

The Rabbit Polyclonal anti-HECTD3 antibody is suitable to detect HECTD3 in samples from Human, Mouse and Rat. It has been validated for WB, IHC (p) and FACS.

Quick Overview for HECTD3 antibody (ABIN7880991)

Target: HECTD3 (HECT Domain Containing 3 (HECTD3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HECTD3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Product Details anti-HECTD3 Antibody

Purpose: HECTD3 Antibody

Sequence: HYASAKVCEE KLRYAAYNCV AIDTDMSPWE E

Purification: Antigen affinity purified

Immunogen: Amino acids HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE from the human protein were used as the immunogen for the HECTD3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HECTD3 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the HECTD3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for HECTD3

Target: HECTD3 (HECT Domain Containing 3 (HECTD3))

Alternative Name: HECTD3

Background: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.

UniProt: Q5T447