HMGB1 antibody

Catalog No. ABIN7881044

This Mouse Monoclonal antibody specifically detects HMGB1 in WB, FACS and IHC (p). It exhibits reactivity toward Human, Mouse, Rat and Monkey.

Quick Overview for HMGB1 antibody (ABIN7881044)

Target: HMGB1 (High Mobility Group Box 1 (HMGB1))

Reactivity: Human, Mouse, Rat, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This HMGB1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 5H3

Product Details anti-HMGB1 Antibody

Purpose: HMGB1 Antibody

Sequence: DVAKKLGEMW NNTAADDKQP YEKKAAKLKE K

Purification: Affinity purified

Immunogen: Amino acids DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK were used as the immunogen for the HMGB1 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the HMGB1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the HMGB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for HMGB1

Target: HMGB1 (High Mobility Group Box 1 (HMGB1))

Alternative Name: HMGB1

Background: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

UniProt: P09429

Pathways: p53 Signaling, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, Inflammasome