RHOB antibody

Catalog No. ABIN7882139

The Rabbit Polyclonal anti-RHOB antibody (ABIN7882139) specifically detects RHOB in WB, IF and IHC (p). The antibody is reactive with Human, Mouse, Rat and Monkey samples.

Quick Overview for RHOB antibody (ABIN7882139)

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Reactivity: Human, Mouse, Rat, Monkey

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOB antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-RHOB Antibody

Purpose: RHOB Antibody

Sequence: NKKDLRSDEH VRTELARMKQ EPVRTDDGRA MAVRIQAYDY LE

Purification: Antigen affinity purified

Immunogen: Amino acids NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE from the human protein were used as the immunogen for the RHOB antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the RHOB antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the RHOB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for RHOB

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Alternative Name: RHOB

Background: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.

UniProt: P62745