SUMO1 antibody

Catalog No. ABIN7882287

This Rabbit Polyclonal antibody specifically detects SUMO1 in IF, FACS and IHC (p). It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for SUMO1 antibody (ABIN7882287)

Target: SUMO1 (Small Ubiquitin Related Modifier Protein 1 (SUMO1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUMO1 antibody is un-conjugated

Application: Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-SUMO1 Antibody

Purpose: SUMO1 Antibody

Sequence: HLKKLKESYC QRQGVPMNSL RFLFEGQRIA DNHTPKEL

Purification: Affinity purified

Immunogen: Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SUMO1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for SUMO1

Target: SUMO1 (Small Ubiquitin Related Modifier Protein 1 (SUMO1))

Alternative Name: SUMO1

Background: Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.

UniProt: P63165

Pathways: M Phase, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus, Ubiquitin Proteasome Pathway