Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Aquaporin 4 antibody (C-Term, Intracellular)

The Rabbit Polyclonal anti-Aquaporin 4 antibody (ABIN7884767) specifically detects Aquaporin 4 in WB, IHC, IF, FACS and IC. The antibody is reactive with Human, Mouse and Rat samples.
Catalog No. ABIN7884767
$1,466.46
Plus shipping costs $50.00
200 μL
Shipping to: United States
Delivery in 11 to 14 Business Days

Quick Overview for Aquaporin 4 antibody (C-Term, Intracellular) (ABIN7884767)

Target

See all Aquaporin 4 (AQP4) Antibodies
Aquaporin 4 (AQP4)

Reactivity

  • 123
  • 98
  • 94
  • 4
  • 4
  • 1
  • 1
  • 1
  • 1
Human, Mouse, Rat

Host

  • 130
  • 39
  • 1
  • 1
Rabbit

Clonality

  • 118
  • 52
  • 1
Polyclonal

Conjugate

  • 80
  • 18
  • 8
  • 7
  • 5
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
This Aquaporin 4 antibody is un-conjugated

Application

  • 99
  • 84
  • 50
  • 38
  • 29
  • 23
  • 20
  • 16
  • 14
  • 14
  • 6
  • 5
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Flow Cytometry (FACS), Immunochromatography (IC)

Grade

Carrier-free, KO Validated
  • Binding Specificity

    • 47
    • 16
    • 16
    • 13
    • 7
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 249-323, C-Term, Intracellular

    Purpose

    A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel

    Predicted Reactivity

    Mouse - 73,75 amino acid residues identical, human - 69, bovine - 71, rabbit - 64

    Purification

    The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

    Immunogen

    GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4

    Isotype

    IgG
  • Application Notes

    WB: 1:1000

    FC: The optimal concentration should be determined by the user

    ICC: The optimal concentration should be determined by the user

    IHC: The optimal concentration should be determined by the user

    IP: The optimal concentration should be determined by the user

    Restrictions

    For Research Use only
  • Format

    Lyophilized

    Reconstitution

    0.2 mL double distilled water (DDW)

    Concentration

    1 mg/mL

    Buffer

    PBS pH 7.4

    Preservative

    Without preservative

    Storage

    -20 °C

    Storage Comment

    The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
  • Target

    Aquaporin 4 (AQP4)

    Alternative Name

    WCH4

    Background

    Synonyms: WCH4, Mercurial-insensitive water channel

    Description: Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.

    Gene ID

    25293

    UniProt

    P47863

    Pathways

    Sensory Perception of Sound
You are here:
Chat with us!