Aquaporin 4 antibody (C-Term, Intracellular)

Catalog No. ABIN7884767

The Rabbit Polyclonal anti-Aquaporin 4 antibody (ABIN7884767) specifically detects Aquaporin 4 in WB, IHC, IF, FACS and IC. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for Aquaporin 4 antibody (C-Term, Intracellular) (ABIN7884767)

Target: Aquaporin 4 (AQP4)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aquaporin 4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Flow Cytometry (FACS), Immunochromatography (IC)

Grade: Carrier-free, KO Validated

Product Details anti-Aquaporin 4 Antibody

Binding Specificity: AA 249-323, C-Term, Intracellular

Purpose: A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel

Predicted Reactivity: Mouse - 73,75 amino acid residues identical, human - 69, bovine - 71, rabbit - 64

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen: GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4

Isotype: IgG

Application Details

Application Notes:

WB: 1:1000

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW)

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Preservative: Without preservative

Storage: -20 °C

Storage Comment: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Target Details for Aquaporin 4

Target: Aquaporin 4 (AQP4)

Alternative Name: WCH4

Background:

Synonyms: WCH4, Mercurial-insensitive water channel

Description: Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.

Gene ID: 25293

UniProt: P47863

Pathways: Sensory Perception of Sound