Aquaporin 4 antibody (C-Term, Intracellular)
Quick Overview for Aquaporin 4 antibody (C-Term, Intracellular) (ABIN7884767)
Target
See all Aquaporin 4 (AQP4) AntibodiesReactivity
Host
Clonality
Conjugate
Application
Grade
-
-
Binding Specificity
- AA 249-323, C-Term, Intracellular
-
Purpose
- A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel
-
Predicted Reactivity
- Mouse - 73,75 amino acid residues identical, human - 69, bovine - 71, rabbit - 64
-
Purification
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
-
Immunogen
- GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4
-
Isotype
- IgG
-
-
-
-
Application Notes
-
WB: 1:1000
FC: The optimal concentration should be determined by the user
ICC: The optimal concentration should be determined by the user
IHC: The optimal concentration should be determined by the user
IP: The optimal concentration should be determined by the user
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- 0.2 mL double distilled water (DDW)
-
Concentration
- 1 mg/mL
-
Buffer
- PBS pH 7.4
-
Preservative
- Without preservative
-
Storage
- -20 °C
-
Storage Comment
- The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
-
-
- Aquaporin 4 (AQP4)
-
Alternative Name
- WCH4
-
Background
-
Synonyms: WCH4, Mercurial-insensitive water channel
Description: Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.
-
Gene ID
- 25293
-
UniProt
- P47863
-
Pathways
- Sensory Perception of Sound
Target
-