GNAQ antibody

Catalog No. ABIN8093223

The Mouse Monoclonal anti-GNAQ antibody (Clone 13H4) (ABIN8093223) specifically detects GNAQ in WB, FACS and IHC (p). The antibody is reactive with Human, Mouse, Rat and Monkey samples.

Quick Overview for GNAQ antibody (ABIN8093223)

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reactivity: Human, Mouse, Rat, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This GNAQ antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 13H4

Product Details anti-GNAQ Antibody

Purpose: GNAQ Antibody / Guanine nucleotide binding protein Gq subunit alpha

Sequence: KYEHNKAHAQ LVREVDVEKV SAFENPYVDA IKSLWND

Purification: Purified

Immunogen: Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND from the human protein were used as the immunogen for the GNAQ antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the GNAQ antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the GNAQ antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for GNAQ

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Alternative Name: GNAQ

Background: GNAQ Antibody targets Guanine nucleotide binding protein Gq subunit alpha, a heterotrimeric G protein alpha subunit encoded by the GNAQ gene. GNAQ is a member of the Gq family of G proteins that couple activated G protein-coupled receptors to downstream intracellular signaling pathways. Upon receptor stimulation, GNAQ exchanges GDP for GTP and dissociates from the beta-gamma complex, allowing it to activate effector enzymes that regulate second messenger production. This signaling mechanism plays a central role in transducing extracellular cues into coordinated cellular responses.

Guanine nucleotide binding protein Gq subunit alpha primarily functions by activating phospholipase C beta isoforms. Activation of phospholipase C beta leads to hydrolysis of phosphatidylinositol 4,5-bisphosphate, generating inositol 1,4,5-trisphosphate and diacylglycerol. These second messengers promote intracellular calcium release and activation of protein kinase C, respectively. Through this pathway, GNAQ influences diverse biological processes including cell proliferation, differentiation, secretion, and cytoskeletal dynamics. A short functional summary is that GNAQ serves as a molecular switch linking receptor activation to calcium-dependent and protein kinase C-mediated signaling cascades.

GNAQ is broadly expressed across many tissues and cell types, reflecting its involvement in multiple physiological systems. It is found in epithelial cells, endothelial cells, immune cells, and neurons, with localization predominantly at the cytoplasmic face of the plasma membrane where G protein-coupled receptors reside. Expression and activity of GNAQ are dynamically regulated in response to extracellular ligands such as hormones, neurotransmitters, and growth factors, enabling precise control of signal amplitude and duration.

From a disease relevance perspective, dysregulation of GNAQ signaling has been associated with several pathological conditions. Somatic activating mutations in GNAQ have been identified in uveal melanoma and other vascular and melanocytic disorders, where constitutive activation of downstream signaling promotes abnormal cell growth and survival. Altered GNAQ-mediated signaling has also been examined in cardiovascular disease, inflammatory responses, and neurological signaling pathways. These findings underscore the importance of tightly regulated GNAQ activity for maintaining cellular homeostasis.

A GNAQ Antibody is a useful research tool for detecting guanine nucleotide binding protein Gq subunit alpha expression and studying its regulation in cellular and tissue-based systems. Detection of GNAQ supports investigations into G protein-coupled receptor signaling, calcium-mediated signal transduction, and disease-associated alterations in Gq pathway activity. This antibody targets guanine nucleotide binding protein Gq subunit alpha for use in research applications focused on signal transduction and cell communication biology.

UniProt: P50148

Pathways: JAK-STAT Signaling, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction