AICDA antibody (N-Term)

Catalog No. ABIN8093920

This Rabbit Polyclonal antibody specifically detects AICDA in IHC. It exhibits reactivity toward Human, Mouse, Rat, Rabbit, Dog, Cow, Pig, Guinea Pig and Horse.

Quick Overview for AICDA antibody (N-Term) (ABIN8093920)

Target: AICDA (Activation-Induced Cytidine Deaminase (AICDA))

Reactivity: Human, Mouse, Rat, Rabbit, Dog, Cow, Pig, Guinea Pig, Horse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AICDA antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-AICDA Antibody

Binding Specificity: N-Term

Purpose: AICDA Antibody N-terminal region

Sequence: VKRRDSATSF SLDFGYLRNK NGCHVELLFL RYISDWDLDP GRCYRVTWFT

Predicted Reactivity: Cow: 93%, Dog: 100%, Guinea Pig: 93%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 100%, Rabbit: 100%, Rat: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63254-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for AICDA

Target: AICDA (Activation-Induced Cytidine Deaminase (AICDA))

Alternative Name: AICDA

Background:

Background Information: This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).

Gene Name: activation-induced cytidine deaminase

Alternative Symbols: AID, ARP2, CDA2, HIGM2, HEL-S-284

Protein Name: Activation-induced cytidine deaminase

Molecular Weight: 24 kDa

Gene ID: 57379

NCBI Accession: NP_065712

UniProt: Q9GZX7

Pathways: Cellular Response to Molecule of Bacterial Origin, Regulation of Actin Filament Polymerization, Production of Molecular Mediator of Immune Response