CDKN2C antibody

Catalog No. ABIN8098208

The Rabbit Polyclonal anti-CDKN2C antibody is suitable to detect CDKN2C in samples from Human, Mouse, Rat, Dog, Cow, Guinea Pig, Horse, Pig and Rabbit. It has been validated for IHC.

Quick Overview for CDKN2C antibody (ABIN8098208)

Target: CDKN2C (Cyclin-Dependent Kinase Inhibitor 2C (p18, Inhibits CDK4) (CDKN2C))

Reactivity: Human, Mouse, Rat, Dog, Cow, Guinea Pig, Horse, Pig, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDKN2C antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-CDKN2C Antibody

Purpose: CDKN2C Antibody

Sequence: VMKLGNPEIA RRLLLRGANP DLKDRTGFAV IHDAARAGFL DTLQTLLEFQ

Predicted Reactivity: Cow: 100%, Dog: 100%, Guinea Pig: 92%, Horse: 100%, Human: 100%, Mouse: 91%, Pig: 100%, Rabbit: 100%, Rat: 92%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP30196-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for CDKN2C

Target: CDKN2C (Cyclin-Dependent Kinase Inhibitor 2C (p18, Inhibits CDK4) (CDKN2C))

Alternative Name: CDKN2C

Background:

Background Information: The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

Gene Name: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)

Alternative Symbols: p18, INK4C, p18-INK4C

Protein Name: Cyclin-dependent kinase 4 inhibitor C

Molecular Weight: 18 kDa

Gene ID: 1031

NCBI Accession: NP_001253

UniProt: P42773

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases