TNFAIP3 antibody

Catalog No. ABIN8115018

The Rabbit Polyclonal anti-TNFAIP3 antibody (ABIN8115018) specifically detects TNFAIP3 in IHC. The antibody is reactive with Human, Mouse, Rat, Dog, Rabbit, Cow and Horse samples.

Quick Overview for TNFAIP3 antibody (ABIN8115018)

Target: TNFAIP3 (Tumor Necrosis Factor, alpha-Induced Protein 3 (TNFAIP3))

Reactivity: Human, Mouse, Rat, Dog, Rabbit, Cow, Horse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNFAIP3 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-TNFAIP3 Antibody

Purpose: TNFAIP3 Antibody

Sequence: LGSTMFEGYC QKCFIEAQNQ RFHEAKRTEE QLRSSQRRDV PRTTQSTSRP

Predicted Reactivity: Cow: 77%, Dog: 77%, Horse: 85%, Human: 100%, Mouse: 83%, Rabbit: 100%, Rat: 83%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61326-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for TNFAIP3

Target: TNFAIP3 (Tumor Necrosis Factor, alpha-Induced Protein 3 (TNFAIP3))

Alternative Name: TNFAIP3

Background:

Background Information: This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.

Gene Name: tumor necrosis factor, alpha-induced protein 3

Alternative Symbols: A20, AISBL, OTUD7C, TNFA1P2

Protein Name: Tumor necrosis factor alpha-induced protein 3

Molecular Weight: 90 kDa

Gene ID: 7128

NCBI Accession: NP_006281

UniProt: P21580

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Production of Molecular Mediator of Immune Response