anti-Human TXNDC11 antibody for Immunofluorescence

Recommended TXNDC11 Antibody (supplied by: Log in to see )

Antigen
Thioredoxin Domain Containing 11 (TXNDC11) Antibodies
  • EFP1
  • 2810408E11Rik
  • AI427833
  • Txdc11
  • RGD1307538
  • thioredoxin domain containing 11
  • TXNDC11
  • Txndc11
Reactivity
Human
43
15
15
1
Host
Rabbit
25
18
Clonality
Polyclonal
Conjugate
This TXNDC11 antibody is un-conjugated
3
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
24
22
13
8
6
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4363595
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
-1.9026322 ABIN4363596 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0

General

Antigen Thioredoxin Domain Containing 11 (TXNDC11) Antibodies
Reactivity Human
(43), (15), (15), (1)
Host Rabbit
(25), (18)
Clonality
Polyclonal
Conjugate This TXNDC11 antibody is un-conjugated
(3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(24), (22), (13), (8), (6), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-TXNDC11 Antibody

Target Details TXNDC11 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SRTHNVCELCVNQTSGGMKPSSVSVPQCSFFEMAAALDSFYLKEQTFYHVASDSIECSNFLTSYSPFSYYTACCRTISRGVSGFIDSEQGVFEAPTVAFSS
Isotype IgG
Plasmids, Primers & others

Target Details TXNDC11

Product Details anti-TXNDC11 Antibody Application Details Handling Images back to top
Antigen
Alternative Name TXNDC11 (TXNDC11 Antibody Abstract)
Background Gene Symbol: TXNDC11
Gene ID 51061
Pathways Cell RedoxHomeostasis

Application Details

Product Details anti-TXNDC11 Antibody Target Details TXNDC11 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TXNDC11 Antibody Target Details TXNDC11 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-TXNDC11 Antibody Target Details TXNDC11 Application Details Handling back to top
Supplier Images
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Thioredoxin Domain Containing 11 (TXNDC11) antibody (ABIN4363595) Immunohistochemistry-Paraffin: TXNDC11 Antibody - Staining of human heart muscle sho...
Immunofluorescence (IF) image for anti-Thioredoxin Domain Containing 11 (TXNDC11) antibody (ABIN4363595) Immunocytochemistry/Immunofluorescence: TXNDC11 Antibody - Immunofluorescent stainin...