anti-Rat (Rattus) SLC25A22 antibody for Immunocytochemistry

Recommended SLC25A22 Antibody (supplied by: Log in to see )

Antigen
Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) Antibodies
  • 1300006L01Rik
  • AI060884
  • Gc1
  • GC1
  • RGD1307826
  • EIEE3
  • NET44
  • solute carrier family 25 (mitochondrial carrier, glutamate), member 22
  • solute carrier family 25 member 22
  • Slc25a22
  • SLC25A22
Reactivity
Human, Mouse (Murine), Rat (Rattus)
11
8
5
3
3
2
2
2
2
1
Host
Rabbit
11
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
11
5
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4354147
Contact our Customer Service for availability and price in your country.

General

Antigen Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(11), (8), (5), (3), (3), (2), (2), (2), (2), (1)
Host Rabbit
(11)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(11), (5), (3), (2), (1)
Supplier Log in to see

Product Details anti-SLC25A22 Antibody

Target Details SLC25A22 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
Isotype IgG
Plasmids, Primers & others

Target Details SLC25A22

Product Details anti-SLC25A22 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SLC25A22 (SLC25A22 Antibody Abstract)
Background Gene Symbol: SLC25A22
Gene ID 79751
Pathways Dicarboxylic Acid Transport

Application Details

Product Details anti-SLC25A22 Antibody Target Details SLC25A22 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SLC25A22 Antibody Target Details SLC25A22 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SLC25A22 Antibody Target Details SLC25A22 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human pro...
Western Blotting (WB) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Western Blot: SLC25A22 Antibody [NBP1-84880] - Lane 1: Marker [kDa] 230, 130, 95, 72,...
Immunofluorescence (IF) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Immunocytochemistry/Immunofluorescence: SLC25A22 Antibody [NBP1-84880] - Staining of ...
Western Blotting (WB) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Western Blot: SLC25A22 Antibody [NBP1-84880] - Lane 1: NIH-3T3 cell lysate (Mouse emb...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Immunohistochemistry-Paraffin: SLC25A22 Antibody - Staining of human cerebral cortex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Immunohistochemistry-Paraffin: SLC25A22 Antibody - Staining of human prostate shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Immunohistochemistry-Paraffin: SLC25A22 Antibody - Staining of human skeletal muscle...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22) antibody (ABIN4354147) Immunohistochemistry-Paraffin: SLC25A22 Antibody - Staining of human testis shows st...