anti-Rat (Rattus) ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 antibody for Western Blotting

Recommended ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 Antibody

Antigen
ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3) Antibodies
  • siat6
  • st3Gal-III
  • st3galii
  • st3galiii
  • st3n
  • SIAT6
  • EIEE15
  • MRT12
  • ST3GALII
  • ST3GalIII
  • ST3N
  • ST3GAL-III
  • Siat3
  • Siat6
  • ST3GALIII
  • st3gal3
  • zgc:63978
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3 S homeolog
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3a
  • st3gal3.S
  • ST3GAL3
  • St3gal3
  • st3gal3a
Epitope
C-Term
5
4
2
2
2
2
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
60
38
35
7
5
4
4
4
3
2
1
1
1
Host
Rabbit
57
3
Clonality
Polyclonal
Conjugate
Un-conjugated
5
3
3
3
3
3
3
2
2
Application
Western Blotting (WB)
31
12
7
5
2
1
Options

Available images

Catalog No. ABIN630406
$ 369.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
17.559069 ABIN635965 WB Rabbit N-Term Polyclonal 0
16.857681 ABIN2969939 IF/ICC IHC WB Rabbit IgG Polyclonal 0
16.857681 ABIN2560155 IHC WB Rabbit IgG Polyclonal 0
13.857681 ABIN6570682 IF IHC WB Rabbit IgG Polyclonal 0
4.8576813 ABIN2782706 WB Rabbit N-Term Polyclonal 1
4.8576813 ABIN2782705 WB Rabbit C-Term Polyclonal 0
4.8576813 ABIN2707103 WB Rabbit Center Polyclonal 0
4.8576813 ABIN6265302 ELISA WB Rabbit IgG Polyclonal 0
4.8576813 ABIN2463001 ELISA WB Rabbit Polyclonal 0
4.8576813 ABIN2463000 ELISA WB Rabbit Polyclonal 0
4.8576813 ABIN5914972 WB Rabbit Polyclonal 0
4.8576813 ABIN6718357 IF IHC WB Rabbit Polyclonal 0
4 ABIN6738264 WB Rabbit IgG AA 95-144 Polyclonal 0
4 ABIN321141 WB Rabbit IgG C-Term Polyclonal 0
1 ABIN1453959 ELISA WB Rabbit IgG AA 174-223 Polyclonal 0
1 ABIN2884732 ELISA WB Rabbit IgG AA 174-223 Polyclonal 0
1 ABIN2628771 WB Rabbit Internal Region Polyclonal 0
1 ABIN6759902 IF IHC WB Rabbit IgG Polyclonal 0
1 ABIN2886878 WB Rabbit Polyclonal 0
1 ABIN6710475 WB Rabbit Polyclonal 0

General

Antigen ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3) Antibodies
Epitope C-Term
(5), (4), (2), (2), (2), (2), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(60), (38), (35), (7), (5), (4), (4), (4), (3), (2), (1), (1), (1)
Host Rabbit
(57), (3)
Clonality
Polyclonal
Conjugate Un-conjugated
(5), (3), (3), (3), (3), (3), (3), (2), (2)
Application Western Blotting (WB)
(31), (12), (7), (5), (2), (1)
Supplier

Product details

Target Details Application Details Handling Images
Specificity ST3 GAL3 antibody was raised against the C terminal of ST3 AL3
Purification Purified
Immunogen ST3 GAL3 antibody was raised using the C terminal of ST3 AL3 corresponding to a region with amino acids GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name ST3GAL3 (ST3GAL3 Antibody Abstract)
Background ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.
Molecular Weight 30 kDa (MW of target protein)
Pathways Glycosaminoglycan Metabolic Process

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ST3GAL3 Blocking Peptide, catalog no. 33R-3259, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3) (C-Term) antibody (ABIN630406) ST3GAL3 antibody used at 1.25 ug/ml to detect target protein.