anti-Human IL2 Receptor beta antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL2 Receptor beta Antibody (supplied by: Log in to see )

Antigen
Interleukin 2 Receptor, beta (IL2RB) Antibodies
  • IL2RB
  • il-2rb
  • CD122
  • IL15RB
  • P70-75
  • IL2RBC
  • IL-15Rbeta
  • IL15Rbeta
  • Il-2/15Rbeta
  • Il-2Rbeta
  • p70
  • interleukin 2 receptor subunit beta
  • interleukin-2 receptor subunit beta
  • interleukin 2 receptor, beta
  • interleukin 2 receptor, beta chain
  • IL2RB
  • LOC510185
  • il2rb
  • Il2rb
Reactivity
Human
230
196
101
29
12
1
1
Host
Rabbit
150
135
92
Clonality
Polyclonal
Conjugate
This IL2 Receptor beta antibody is un-conjugated
31
30
22
15
9
8
6
6
6
6
6
5
4
4
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
218
137
72
63
42
26
15
15
14
10
9
5
4
3
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4324888
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.925759 ABIN498147 IHC (p) WB Rabbit Log in to see Polyclonal 0
10.925759 ABIN441174 ICC IF IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2878881 ELISA IHC IHC (p) WB Rabbit IgG AA 331-380 Log in to see Polyclonal 0
1 ABIN675923 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1735899 IHC (p) ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN5580855 ELISA IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN6283194 ELISA IHC (p) WB Rabbit IgG AA 300-380 Log in to see Polyclonal 0
1 ABIN5580856 IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN1408346 IHC (p) WB HRP Rabbit IgG pTyr364 Log in to see Polyclonal 0
1 ABIN675932 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN2891897 IHC IHC (p) WB Rabbit Thr360 Log in to see Polyclonal 0
1 ABIN1390453 IHC (p) WB Biotin Rabbit IgG pTyr364 Log in to see Polyclonal 0
1 ABIN675925 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1386499 IF (p) IHC (p) WB Rabbit IgG pTyr364 Log in to see Polyclonal 0
1 ABIN2764888 ELISA IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0

General

Antigen Interleukin 2 Receptor, beta (IL2RB) Antibodies
Reactivity Human
(230), (196), (101), (29), (12), (1), (1)
Host Rabbit
(150), (135), (92)
Clonality
Polyclonal
Conjugate This IL2 Receptor beta antibody is un-conjugated
(31), (30), (22), (15), (9), (8), (6), (6), (6), (6), (6), (5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(218), (137), (72), (63), (42), (26), (15), (15), (14), (10), (9), (5), (4), (3), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL2 Receptor beta Antibody

Target Details IL2 Receptor beta Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
Isotype IgG
Plasmids, Primers & others

Target Details IL2 Receptor beta

Product Details anti-IL2 Receptor beta Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-2 R beta (IL2RB Antibody Abstract)
Background Gene Symbol: IL2RB
Gene ID 3560
UniProt P14784
Pathways JAK-STAT Signaling, Growth Factor Binding

Application Details

Product Details anti-IL2 Receptor beta Antibody Target Details IL2 Receptor beta Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL2 Receptor beta Antibody Target Details IL2 Receptor beta Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL2 Receptor beta Antibody Target Details IL2 Receptor beta Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Interleukin 2 Receptor, beta (IL2RB) antibody (ABIN4324888) Immunohistochemistry: IL2 Receptor beta Antibody [NBP2-34148] - liver
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 2 Receptor, beta (IL2RB) antibody (ABIN4324888) Immunohistochemistry-Paraffin: IL2 Receptor beta Antibody [NBP2-34148] - liver cancer
Immunohistochemistry (IHC) image for anti-Interleukin 2 Receptor, beta (IL2RB) antibody (ABIN4324888) Immunohistochemistry: IL2 Receptor beta Antibody [NBP2-34148] - Immunohistochemical s...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Interleukin 2 Receptor, beta (IL2RB) antibody (ABIN4324888) Immunohistochemistry-Paraffin: IL-2 R beta Antibody - Staining of human lymph node s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 2 Receptor, beta (IL2RB) antibody (ABIN4324888) Immunohistochemistry-Paraffin: IL-2 R beta Antibody - Staining of human cerebral cor...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 2 Receptor, beta (IL2RB) antibody (ABIN4324888) Immunohistochemistry-Paraffin: IL-2 R beta Antibody - Staining in human lymph node a...