anti-Human CD40 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CD40 Antibody (supplied by: Log in to see )

Antigen
CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) Antibodies
  • Bp50
  • CDW40
  • TNFRSF5
  • p50
  • AI326936
  • GP39
  • HIGM1
  • IGM
  • IMD3
  • T-BAM
  • TRAP
  • Tnfrsf5
  • TNFSF5
  • CD40 molecule
  • CD40 antigen
  • CD40
  • Cd40
Reactivity
Human
687
324
75
20
16
10
9
6
4
4
3
2
2
1
1
1
1
1
Host
Mouse
530
210
193
22
7
4
Clonality
Monoclonal
Conjugate
This CD40 antibody is un-conjugated
90
87
51
41
24
21
17
15
15
14
9
9
9
9
9
9
9
8
7
7
7
7
6
6
6
6
5
4
4
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
615
279
225
220
112
103
97
84
50
35
20
19
13
9
8
6
6
4
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4293056
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.925759 ABIN4293028 IHC IHC (p) IP WB Rabbit Log in to see Polyclonal 1
10.925759 ABIN4293054 IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0
10.925759 ABIN4293055 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
10.925759 ABIN337317 FACS IHC IHC (fro) IHC (p) IP Mouse IgG2a Log in to see LOB7-6 0
10.925759 ABIN241554 FACS IHC IHC (p) Mouse IgG1, kappa Log in to see HB14 0
10.925759 ABIN438055 CyTOF FACS IHC IHC (p) WB Mouse IgG2 Log in to see MM0048-9F21 0
10.925759 ABIN784060 IHC (p) IP WB Rabbit IgG C-Term Log in to see Polyclonal 0
10.925759 ABIN444833 FACS IHC (p) Mouse IgG1 kappa Log in to see HB14 0
1 ABIN625924 IHC IHC (p) IP WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN1804378 FACS ICC IHC IHC (fro) IHC (p) IP Mouse IgG2a Log in to see 0
1 ABIN400699 FACS IHC (p) Mouse IgG1 Log in to see HB14 0
1 ABIN2855046 IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN2689245 IHC (fro) FACS IHC (zinc) IHC (p) Mouse IgG1, kappa Log in to see 5C3 2
1 ABIN6285868 ELISA IHC (p) WB Rabbit IgG AA 200-280, C-Term Log in to see Polyclonal 0
1 ABIN5960844 ELISA IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN271944 IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN2480305 IHC (fro) FACS IHC (p) IP Mouse IgG2a Log in to see LOB7-6 4
1 ABIN681838 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2618537 IHC IHC (p) WB Mouse IgG2a AA 21-166 Log in to see 8B8 0
1 ABIN2618540 IHC IHC (p) WB Mouse IgG1 AA 21-166 Log in to see 8G5 0

General

Antigen CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) Antibodies
Reactivity Human
(687), (324), (75), (20), (16), (10), (9), (6), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1)
Host Mouse
(530), (210), (193), (22), (7), (4)
Clonality (Clone)
Monoclonal   ( )
Conjugate This CD40 antibody is un-conjugated
(90), (87), (51), (41), (24), (21), (17), (15), (15), (14), (9), (9), (9), (9), (9), (9), (9), (8), (7), (7), (7), (7), (6), (6), (6), (6), (5), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(615), (279), (225), (220), (112), (103), (97), (84), (50), (35), (20), (19), (13), (9), (8), (6), (6), (4), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CD40 Antibody

Target Details CD40 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Protein A purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
Clone CL1673
Isotype IgG1
Plasmids, Primers & others

Target Details CD40

Product Details anti-CD40 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CD40/TNFRSF5 (CD40 Antibody Abstract)
Background Gene Symbol: CD40
Gene ID 958
UniProt P25942
Pathways NF-kappaB Signaling, Cellular Response to Molecule of Bacterial Origin, M Phase, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-CD40 Antibody Target Details CD40 Handling Images back to top
Application Notes Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CD40 Antibody Target Details CD40 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CD40 Antibody Target Details CD40 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Immunohistochemic...
Immunohistochemistry (IHC) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Immunohistochemic...
Immunohistochemistry (IHC) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Immunohistochemic...
Western Blotting (WB) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Western Blot: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Lane 1: Marker [kDa] Lane...
Immunohistochemistry (IHC) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Immunohistochemic...
Immunohistochemistry (IHC) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Immunohistochemic...
Immunohistochemistry (IHC) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Immunohistochemic...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) - Staining of human ce...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) - Staining of human co...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) - Staining of human to...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) antibody (ABIN4293056) Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) - Staining in human to...