anti-Human BAZ1B antibody for Immunofluorescence

Recommended BAZ1B Antibody (supplied by: Log in to see )

Bromodomain Adjacent To Zinc Finger Domain, 1B (BAZ1B) Antibodies
  • BAZ1B
  • wstf
  • wbscr9
  • wbscr10
  • LOC100220420
  • WBSCR10
  • WBSCR9
  • WSTF
  • C87820
  • Wbscr9
  • fi60d02
  • im:7137554
  • wu:fi60d02
  • bromodomain adjacent to zinc finger domain 1B
  • bromodomain adjacent to zinc finger domain, 1B
  • bromodomain adjacent to zinc finger domain 1B S homeolog
  • BAZ1B
  • baz1b
  • Baz1b
  • baz1b.S
This BAZ1B antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5080549
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN153218 ICC IF IHC IHC (p) IP WB Rabbit AA 1-50 Log in to see Polyclonal 2
1 ABIN1976951 IF IHC (p) Rabbit IgG AA 1-50 Log in to see Polyclonal 0
1 ABIN1976950 ICC IF IP IHC (p) WB Rabbit IgG AA 1-50 Log in to see Polyclonal 0
1 ABIN2589886 DB ICC FACS IF WB Mouse IgG1 Log in to see BAZ1H4H9 0


Antigen Bromodomain Adjacent To Zinc Finger Domain, 1B (BAZ1B) Antibodies
Reactivity Human
(62), (23), (23), (4), (3), (3), (2), (2), (1)
Host Rabbit
(48), (14)
Conjugate This BAZ1B antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(41), (25), (13), (10), (5), (5), (4), (4), (3), (3), (1), (1)
Supplier Log in to see

Product Details anti-BAZ1B Antibody

Target Details BAZ1B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE
Isotype IgG

Target Details BAZ1B

Product Details anti-BAZ1B Antibody Application Details Handling Images back to top
Alternative Name WSTF (BAZ1B Antibody Abstract)
Background Gene Symbol: BAZ1B
Gene ID 9031
Pathways Nuclear Hormone Receptor Binding, Chromatin Binding

Application Details

Product Details anti-BAZ1B Antibody Target Details BAZ1B Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-BAZ1B Antibody Target Details BAZ1B Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-BAZ1B Antibody Target Details BAZ1B Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Bromodomain Adjacent To Zinc Finger Domain, 1B (BAZ1B) antibody (ABIN5080549) Immunocytochemistry/Immunofluorescence: WSTF Antibody - Staining of human cell line ...