anti-Human CHEK2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CHEK2 Antibody (supplied by: Log in to see )

Checkpoint Kinase 2 (CHEK2) Antibodies
  • CDS1
  • CHK2
  • HuCds1
  • LFS2
  • PP1425
  • RAD53
  • hCds1
  • fa66f08
  • wu:fa66f08
  • zgc:55865
  • Cds1
  • HUCDS1
  • Rad53
  • Chk2
  • CHK-2
  • checkpoint kinase 2
  • serine/threonine-protein kinase chk2
  • blue sensitive cone opsin
  • CHEK2
  • chek2
  • Chek2
  • MCYG_07308
  • OPN2SW
AA 465-498, C-Term
Human, Mouse (Murine), Rat (Rattus)
This CHEK2 antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043811
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.624546 ABIN408359 IHC (p) IHC WB Rabbit pThr68 Log in to see Polyclonal 7
12.624546 ABIN213921 ICC IHC (p) WB Rabbit N-Term Log in to see Polyclonal
12.624546 ABIN4297968 FACS ICC IF IHC IHC (p) IP WB Mouse IgG1 Transcript Variant 1 Log in to see 5C4
12.624546 ABIN498829 IHC (p) Rabbit pThr387 Log in to see Polyclonal
12.624546 ABIN4297966 IHC IHC (p) WB Mouse IgG1 Log in to see 73C175-1-1
12.624546 ABIN213892 IHC (p) WB Mouse IgG1 Log in to see 73C175-1-1
12.624546 ABIN4297967 ELISA ICC IF IHC IHC (fro) IHC (p) WB Mouse IgG2b Log in to see 1C12B8
12.624546 ABIN498830 IHC (p) Rabbit pThr68 Log in to see Polyclonal
12.624546 ABIN498917 IHC (p) Rabbit Log in to see Polyclonal
12.624546 ABIN4297972 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
12.624546 ABIN498918 IHC (p) Rabbit Log in to see Polyclonal
12.624546 ABIN4297977 IHC (p) WB Mouse IgG1 Log in to see 73C175-1-1
12.624546 ABIN4297973 IHC IHC (p) IP WB Mouse IgG2a Log in to see DCS-270
1 ABIN487312 IHC (p) IP WB Mouse IgG2a Log in to see DCS-270 4
1 ABIN685867 IF (p) IHC (p) WB Rabbit IgG AA 120-160 Log in to see Polyclonal 1
1 ABIN703165 IF (p) IHC (p) WB Rabbit IgG AA 50-90, pThr68 Log in to see Polyclonal 2
1 ABIN302248 IHC (p) WB Mouse IgG1 Log in to see 73C175-1-1 6
1 ABIN272011 IHC (p) WB Rabbit pSer379 Log in to see Polyclonal
1 ABIN265350 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN271879 IF IHC (p) WB Rabbit Log in to see Polyclonal


Antigen Checkpoint Kinase 2 (CHEK2) Antibodies
Epitope AA 465-498, C-Term
(51), (50), (40), (35), (19), (17), (15), (15), (15), (13), (12), (10), (8), (7), (7), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(479), (212), (192), (19), (19), (16), (13), (8), (5), (4), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(345), (135), (8), (1), (1)
Conjugate This CHEK2 antibody is un-conjugated
(10), (9), (9), (7), (7), (5), (5), (5), (5), (5), (5), (5), (5), (5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(395), (124), (119), (105), (90), (66), (47), (42), (27), (6), (6), (5), (2), (1), (1)
Supplier Log in to see

Product Details anti-CHEK2 Antibody

Target Details CHEK2 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: checkpoint kinase 2
Protein Name: Serine/threonine-protein kinase Chk2
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.
Isotype IgG

Target Details CHEK2

Product Details anti-CHEK2 Antibody Application Details Handling Images back to top
Alternative Name CHEK2 (CHEK2 Antibody Abstract)
Background CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.

Synonyms: bA444G7 antibody|CDS 1 antibody|CDS1 antibody|Checkpoint kinase 2 antibody|Checkpoint like protein CHK2 antibody|Chek 2 antibody|Chek2 antibody|Chk 2 antibody|CHK2 checkpoint homolog (S. pombe) antibody|CHK2 checkpoint homolog antibody|CHK2_HUMAN antibody|HuCds 1 antibody| HuCds1 antibody|LFS 2 antibody|LFS2 antibody|PP1425 antibody|RAD 53 antibody|RAD53 antibody|Rad53 homolog antibody|Serine/threonine protein kinase Chk2 antibody| Serine/ threonine-protein kinase Chk2 antibody
Gene ID 11200
UniProt O96017
Pathways p53 Signaling, Apoptosis, Cell Division Cycle

Application Details

Product Details anti-CHEK2 Antibody Target Details CHEK2 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only


Product Details anti-CHEK2 Antibody Target Details CHEK2 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-CHEK2 Antibody Target Details CHEK2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (ABIN3043811) anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (ABIN3043811) anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (Image 2)