GFP Protein (AA 1-238) (His tag)
-
- Target See all GFP Proteins
- GFP (Green Fluorescent Protein (GFP))
- Protein Type
- Recombinant
- Protein Characteristics
- AA 1-238
-
Origin
- Various Species
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This GFP protein is labelled with His tag.
- Application
- SDS-PAGE (SDS), Western Blotting (WB), Positive Control (PC), Immunogen (Imm)
- Sequence
- S-Met1-Lys238-TRTRPLEQKL ISEEDLAAND ILDYKDDDDK V
- Characteristics
- Recombinant Green Fluorescent Protein (GFP), Prokaryotic expression, S-Met1-Lys238myc-FLAG tag, N-terminal His Tag
- Purity
- > 90 %
- Top Product
- Discover our top product GFP Protein
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Isoelectric Point:5.1
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- PBS, pH7.4, containing 20% Glycerine
- Storage
- 4 °C,-80 °C
- Storage Comment
- Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
- Expiry Date
- 12 months
-
- Target
- GFP (Green Fluorescent Protein (GFP))
- Alternative Name
- Green Fluorescent Protein (GFP Products)
- Synonyms
- green fluorescent protein Protein, gfp Protein
- Target Type
- Viral Protein
- Molecular Weight
- 37kDa
-