anti-Rat (Rattus) UNC93B1 antibody for Western Blotting

Recommended UNC93B1 Antibody (supplied by: Log in to see )

Antigen
Unc-93 Homolog B1 (C. Elegans) (UNC93B1) Antibodies
  • UNC93
  • IIAE1
  • UNC93B
  • Unc-93B1
  • Unc93b
  • unc-93 homolog B1, TLR signaling regulator
  • unc-93 homolog B1 (C. elegans)
  • UNC93B1
  • Unc93b1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
30
21
20
5
3
2
2
2
1
Host
Rabbit
30
1
Clonality
Polyclonal
Application
Western Blotting (WB)
29
11
10
9
3
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN630393
$ 437.50
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7.8026066 ABIN615007 EIA IHC (p) WB Rabbit N-Term Log in to see Polyclonal 0
7.8026066 ABIN1031653 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal 0
7 ABIN343917 ELISA IHC IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
5.5 ABIN1003411 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 2
4.8026066 ABIN2783996 WB Rabbit N-Term Log in to see Polyclonal 1
4.8026066 ABIN2463309 ELISA WB Rabbit Log in to see Polyclonal 0
4.8026066 ABIN5966015 WB Rabbit IgG Log in to see Polyclonal 0
4.8026066 ABIN3024029 WB Rabbit IgG C-Term Log in to see Polyclonal 0
4 ABIN321713 WB Rabbit IgG AA 61-110 Log in to see Polyclonal 0
4 ABIN207765 WB Rabbit IgG AA 500-550 Log in to see Polyclonal 0
4 ABIN1386855 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN1740587 IHC (p) ELISA WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN2745212 WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN6252539 WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN5555409 EIA IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN6292324 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1888104 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal 0

General

Antigen Unc-93 Homolog B1 (C. Elegans) (UNC93B1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(30), (21), (20), (5), (3), (2), (2), (2), (1)
Host Rabbit
(30), (1)
Clonality
Polyclonal
Application Western Blotting (WB)
(29), (11), (10), (9), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-UNC93B1 Antibody

Target Details UNC93B1 Application Details Handling Images
Purification Purified
Immunogen UNC93 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK
Plasmids, Primers & others

Target Details UNC93B1

Product Details anti-UNC93B1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name UNC93B1 (UNC93B1 Antibody Abstract)
Background UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.
Molecular Weight 67 kDa (MW of target protein)
Pathways TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades

Application Details

Product Details anti-UNC93B1 Antibody Target Details UNC93B1 Handling Images back to top
Application Notes WB: 5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

UNC93B1 Blocking Peptide, catalog no. 33R-5095, is also available for use as a blocking control in assays to test for specificity of this UNC93B1 antibody

Restrictions For Research Use only

Handling

Product Details anti-UNC93B1 Antibody Target Details UNC93B1 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC90 1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-UNC93B1 Antibody Target Details UNC93B1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Unc-93 Homolog B1 (C. Elegans) (UNC93B1) antibody (ABIN630393) UNC93B1 antibody used at 5 ug/ml to detect target protein.