anti-Dog (Canine) WNT2B antibody for Western Blotting

Recommended WNT2B Antibody (supplied by: Log in to see )

Antigen
Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B) Antibodies
  • wnt2b
  • WNT2B
  • Wnt13
  • WNT13
  • XWNT2
  • XWnt-2
  • Xwnt-2b
  • wnt-2b
  • xwnt2b
  • wingless-type MMTV integration site family, member 2Ba
  • Wnt family member 2B
  • wingless-type MMTV integration site family, member 2B
  • Wnt family member 2B L homeolog
  • wnt2ba
  • WNT2B
  • Wnt2b
  • wnt2b.L
Epitope
Middle Region
15
13
7
5
2
2
2
2
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
68
38
32
13
12
11
10
10
9
8
7
5
2
1
1
1
Host
Rabbit
67
2
Clonality
Polyclonal
Conjugate
This WNT2B antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
33
25
23
13
9
4
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN629639
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
15.319987 ABIN2776710 IHC WB Rabbit Middle Region Log in to see Polyclonal 1
10.819987 ABIN2776711 IHC WB Rabbit Middle Region Log in to see Polyclonal 0
7 ABIN203089 IHC IHC (p) WB Rabbit IgG AA 229-278 Log in to see Polyclonal 0
7 ABIN959040 IHC IHC (p) WB Rabbit AA 229-278 Log in to see Polyclonal 0
4.819988 ABIN2462377 IHC ELISA WB Rabbit Log in to see Polyclonal 0

General

Antigen Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B) Antibodies
Epitope Middle Region
(15), (13), (7), (5), (2), (2), (2), (2), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
(68), (38), (32), (13), (12), (11), (10), (10), (9), (8), (7), (5), (2), (1), (1), (1)
Host Rabbit
(67), (2)
Clonality
Polyclonal
Conjugate This WNT2B antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(33), (25), (23), (13), (9), (4), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-WNT2B Antibody

Target Details WNT2B Application Details Handling Images
Specificity WNT2 B antibody was raised against the middle region of WNT2
Purification Purified
Immunogen WNT2 B antibody was raised using the middle region of WNT2 corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
Plasmids, Primers & others

Target Details WNT2B

Product Details anti-WNT2B Antibody Application Details Handling Images back to top
Antigen
Alternative Name WNT2B (WNT2B Antibody Abstract)
Background WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis.
Molecular Weight 41 kDa (MW of target protein)
Pathways WNT Signaling

Application Details

Product Details anti-WNT2B Antibody Target Details WNT2B Handling Images back to top
Application Notes WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody

Restrictions For Research Use only

Handling

Product Details anti-WNT2B Antibody Target Details WNT2B Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-WNT2B Antibody Target Details WNT2B Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B) (Middle Region) antibody (ABIN629639) WNT2B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Western Blotting (WB) image for anti-Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B) (Middle Region) antibody (ABIN629639) WNT2B antibody used at 1.25 ug/ml to detect target protein.