anti-Human WNT6 antibody for Immunohistochemistry

Recommended WNT6 Antibody (supplied by: Log in to see )

Wingless-Type MMTV Integration Site Family, Member 6 (WNT6) Antibodies
  • FPS
  • WNT6
  • si:dkey-31m21.2
  • Wnt6
  • AA409270
  • Wnt-6
  • Xwnt-6
  • wnt-6
  • wnt6-A
  • xWnt6
  • FES proto-oncogene, tyrosine kinase
  • Wnt family member 6
  • wingless-type MMTV integration site family, member 6b
  • wingless-type MMTV integration site family, member 6
  • Wnt family member 6 S homeolog
  • FES
  • WNT6
  • Wnt6
  • wnt6b
  • wnt6.S
This WNT6 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN4366195
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN293250 IHC ELISA WB Sheep IgG AA 35-75 Log in to see Polyclonal 0
1 ABIN2390284 IHC ELISA WB Sheep IgG AA 35-75 Log in to see Polyclonal 0
1 ABIN2390280 IHC Rabbit N-Term Log in to see Polyclonal 0
1 ABIN2390282 IHC Rabbit Log in to see Polyclonal 0
1 ABIN3060832 IHC WB Rabbit Log in to see Polyclonal 0


Antigen Wingless-Type MMTV Integration Site Family, Member 6 (WNT6) Antibodies
Reactivity Human
(67), (32), (27), (7), (7), (7), (5), (4), (2), (2), (2), (2)
Host Rabbit
(70), (2), (1)
Conjugate This WNT6 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(49), (19), (13), (12), (8), (2), (1), (1)
Supplier Log in to see

Product Details anti-WNT6 Antibody

Target Details WNT6 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFR F
Isotype IgG

Target Details WNT6

Product Details anti-WNT6 Antibody Application Details Handling Images back to top
Alternative Name Wnt-6 (WNT6 Antibody Abstract)
Background Gene Symbol: WNT6
Gene ID 7475
Pathways WNT Signaling, Tube Formation

Application Details

Product Details anti-WNT6 Antibody Target Details WNT6 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-WNT6 Antibody Target Details WNT6 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.