Sirtuin 1 (SIRT1) (N-Term) antibody

Details for Product No. ABIN182554
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIR2L1, SIR2, sir2l1, sirtuin, AA673258, Sir2, Sir2a, Sir2alpha, sirtuin 1
Epitope
N-Term
(17), (16), (12), (10), (10), (5), (5), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Xenopus laevis, Human, Chicken
(143), (88), (43), (26), (24), (13), (13), (6), (1)
Host
Rabbit
(116), (25), (8), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(10), (7), (5), (4), (4), (4), (4), (4), (4), (4), (4), (1), (1), (1)
Application
Western Blotting (WB)
(116), (73), (40), (35), (34), (23), (16), (10), (6), (6), (2), (1), (1)
Pubmed 2 references available
Catalog no. ABIN182554
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SIRT1
Sequence PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDA VKLLQECKKI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Chicken : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against SIRT1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIRT1
Background SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined,
Molecular Weight 82 kDa
Gene ID 23411
NCBI Accession NM_012238, NP_036370
UniProt Q96EB6
Research Area Chromatin and Nuclear Signaling, Apoptosis/Necrosis, Proteases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 747 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sirtuin 1 (SIRT1) (N-Term) antibody anti-Sirtuin 1 (SIRT1) (N-Term) antibody
Product cited in: Anavekar, Mirza, Skali et al.: "Risk assessment in patients with depressed left ventricular function after myocardial infarction using the myocardial performance index--Survival and Ventricular Enlargement (SAVE) experience." in: Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography, Vol. 19, Issue 1, pp. 28-33, 2006 (PubMed).

Background publications Solomon, Pasupuleti, Xu et al.: "Inhibition of SIRT1 catalytic activity increases p53 acetylation but does not alter cell survival following DNA damage." in: Molecular and cellular biology, Vol. 26, Issue 1, pp. 28-38, 2005 (PubMed).

Hosts (116), (25), (8), (7)
Reactivities (143), (88), (43), (26), (24), (13), (13), (6), (1)
Applications (116), (73), (40), (35), (34), (23), (16), (10), (6), (6), (2), (1), (1)
Conjugates (10), (7), (5), (4), (4), (4), (4), (4), (4), (4), (4), (1), (1), (1)
Epitopes (17), (16), (12), (10), (10), (5), (5), (3), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top