Did you know that you can buy products from over 140 different suppliers from us?

Chromobox Homolog 3 (CBX3) (Middle Region) antibody

Details for Product No. ABIN183071
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Hp1-gamma, HECH, HP1-GAMMA, HP1Hs-gamma, HP1g, M32, cbx3, cbx3a, xhp1g
Epitope
Middle Region
(13), (11), (7), (5), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(76), (56), (49), (19), (13), (13), (3), (1), (1)
Host
Rabbit
(59), (11), (10), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(58), (38), (22), (20), (19), (12), (10), (6), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183071
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CBX3
Sequence WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESD DSKSKKKRDA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Pig : 90 %, Chicken : 80 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against CBX3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CBX3
Background At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. CBX3 binds DNA and is a component of heterochromatin. CBX3 also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of CBX3 may explain the association of heterochromatin with the inner nuclear membrane.At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.
Molecular Weight 21 kDa
Gene ID 11335
NCBI Accession NM_007276, NP_009207
UniProt Q13185
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 183 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromobox Homolog 3 (CBX3) (Middle Region) antibody WB Suggested Anti-CBX3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183071
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top