Proliferating Cell Nuclear Antigen (PCNA) (C-Term) antibody

Details for Product No. ABIN184165
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
PCNAR, Pcna/cyclin, 53/13, CG9193, DmPCNA, Dmel\\CG9193, MUS209, Mus209, PCNA, PCNA/mus209, Pcna, dPCNA, l(2)02448, l(2)56F, l(2)56Fa, l(2)s1534, pcna, cb16, fb36g03, wu:fa28e03, wu:fb36g03, AO0900030 ... show more
PCNAR, Pcna/cyclin, 53/13, CG9193, DmPCNA, Dmel\\CG9193, MUS209, Mus209, PCNA, PCNA/mus209, Pcna, dPCNA, l(2)02448, l(2)56F, l(2)56Fa, l(2)s1534, pcna, cb16, fb36g03, wu:fa28e03, wu:fb36g03, AO090003000846 show less
Epitope
C-Term
(21), (14), (12), (12), (5), (5), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(312), (181), (144), (78), (67), (63), (13), (13), (13), (12), (9), (9), (6), (5), (4), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(182), (176), (5), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(20), (18), (6), (6), (6), (6), (6), (6), (6), (6), (6), (4), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(251), (122), (94), (73), (60), (57), (52), (32), (28), (24), (4), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184165
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PCNA
Sequence LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL APKIEDEEGS
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PCNA. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name PCNA
Background PCNA is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Molecular Weight 29 kDa
Gene ID 5111
NCBI Accession NM_002592, NP_002583
UniProt P12004
Research Area Cancer, Cell Cycle, Chromatin Binding Proteins, DNA/RNA, Proliferation Markers
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 261 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proliferating Cell Nuclear Antigen (PCNA) (C-Term) antibody WB Suggested Anti-PCNA Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
anti-Proliferating Cell Nuclear Antigen (PCNA) (C-Term) antibody (2) Sample Type: 1. Human NT-2 cells (60ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science
anti-Proliferating Cell Nuclear Antigen (PCNA) (C-Term) antibody (3) Sample Type: NT2 cells
Red: Antibody
Blue: DAPI
Primary Dilution: 1ug/50ul antibody
Secondary Antibody: Alexa goat anti-rabbit 594
Image Submitted by: Yuzhi Chen, University of Arkansas for Medical Sciences
Background publications Senga, Sivaprasad, Zhu et al.: "PCNA is a cofactor for Cdt1 degradation by CUL4/DDB1-mediated N-terminal ubiquitination." in: The Journal of biological chemistry, Vol. 281, Issue 10, pp. 6246-52, 2006 (PubMed).

Hosts (182), (176), (5), (2)
Reactivities (312), (181), (144), (78), (67), (63), (13), (13), (13), (12), (9), (9), (6), (5), (4), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (251), (122), (94), (73), (60), (57), (52), (32), (28), (24), (4), (2), (2), (1), (1), (1), (1)
Conjugates (20), (18), (6), (6), (6), (6), (6), (6), (6), (6), (6), (4), (1), (1), (1), (1)
Epitopes (21), (14), (12), (12), (5), (5), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
back to top