Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184165

Proliferating Cell Nuclear Antigen (PCNA) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
PCNAR, Pcna/cyclin, 53/13, CG9193, DmPCNA, Dmel\\CG9193, MUS209, Mus209, PCNA, PCNA/mus209, Pcna, dPCNA, l(2)02448, l(2)56F, l(2)56Fa, l(2)s1534, pcna, cb16, fb36g03, wu:fa28e03, wu:fb36g03, AO0900030 ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184165
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCNA antibody: synthetic peptide directed towards the C terminal of human PCNA
Sequence LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL APKIEDEEGS
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 91%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against PCNA. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name PCNA
Background PCNA is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Molecular Weight 29kDa
Gene ID 5111
NCBI Accession NP_002583, NM_002592
UniProt P12004
Research Area Cancer, Cell Cycle, Chromatin Binding Proteins, DNA/RNA, Proliferation Markers
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCNA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Senga, Sivaprasad, Zhu et al.: "PCNA is a cofactor for Cdt1 degradation by CUL4/DDB1-mediated N-terminal ubiquitination." in: The Journal of biological chemistry, Vol. 281, Issue 10, pp. 6246-52, 2006 (PubMed).

Alternatives for antigen "Proliferating Cell Nuclear Antigen (PCNA)", type "Antibodies"
Hosts (180), (168), (5), (2)
Reactivities (307), (171), (132), (82), (70), (67), (14), (14), (13), (9), (8), (8), (8), (6), (6), (5), (5), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Applications (238), (136), (88), (61), (60), (58), (53), (37), (26), (22), (8), (3), (2), (2), (1), (1), (1), (1), (1)
Conjugates (21), (17), (6), (6), (6), (6), (6), (6), (6), (6), (6), (4), (1), (1), (1), (1)
Epitopes (19), (13), (12), (12), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon