SLC22A2 antibody (AA 524-555)
-
- Target See all SLC22A2 Antibodies
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
-
Binding Specificity
- AA 524-555
-
Reactivity
- Human, Rat, Mouse, Monkey, Orang-Utan
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Specificity
- Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium, in scattered cells in the stroma. .
- Purification
- Immunogen affinity purified
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SLC22A2 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- avoid freeze thaw cycles
- Storage
- 4 °C,-20 °C
- Storage Comment
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
-
- Target
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
- Alternative Name
- SLC22A2 (SLC22A2 Products)
- Synonyms
- OCT2 antibody, Oct2 antibody, Orct2 antibody, OCT2r antibody, rOCT2 antibody, Pou2f2 antibody, OCT2P antibody, oct1 antibody, wu:fc01b11 antibody, zgc:64076 antibody, slc22a2 antibody, solute carrier family 22 member 2 antibody, solute carrier family 22 (organic cation transporter), member 2 antibody, POU class 2 homeobox 2 antibody, solute carrier family 22 (organic cation transporter), member 2 L homeolog antibody, SLC22A2 antibody, Slc22a2 antibody, POU2F2 antibody, LOC521027 antibody, slc22a2 antibody, slc22a2.L antibody
- Background
-
Name/Gene ID: SLC22A2
Subfamily: Organic cation transporter
Family: Transporter
Synonyms: SLC22A2, HOCT2, OCT2, Organic cation transporter 2 - Gene ID
- 6582
-