IDO1 antibody (N-Term)
-
- Target See all IDO1 Antibodies
- IDO1 (Indoleamine 2,3-Dioxygenase 1 (IDO1))
-
Binding Specificity
- AA 37-69, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IDO1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 1(IDO1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- NDWMFIAKHL PDLIESGQLR ERVEKLNMLS IDH
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 1(IDO1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: indoleamine 2,3-dioxygenase 1
Protein Name: Indoleamine 2,3-dioxygenase 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product IDO1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Umbilical Cord Tissue-Derived Mesenchymal Stem Cells Induce T Lymphocyte Apoptosis and Cell Cycle Arrest by Expression of Indoleamine 2, 3-Dioxygenase." in: Stem cells international, Vol. 2016, pp. 7495135, (2016) (PubMed).
: "
-
Umbilical Cord Tissue-Derived Mesenchymal Stem Cells Induce T Lymphocyte Apoptosis and Cell Cycle Arrest by Expression of Indoleamine 2, 3-Dioxygenase." in: Stem cells international, Vol. 2016, pp. 7495135, (2016) (PubMed).
-
- Target
- IDO1 (Indoleamine 2,3-Dioxygenase 1 (IDO1))
- Alternative Name
- IDO1 (IDO1 Products)
- Synonyms
- INDO antibody, ido antibody, indo antibody, IDO antibody, cd107b antibody, IDO1 antibody, IDO-1 antibody, Ido antibody, Indo antibody, indoleamine 2,3-dioxygenase 1 antibody, indoleamine 2,3-dioxygenase 1 L homeolog antibody, indoleamine 2,3-dioxygenase 1-like antibody, IDO1 antibody, ido1.L antibody, ido1 antibody, Ido1 antibody, LOC100050681 antibody
- Background
-
IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.
Synonyms: 3-dioxygenase antibody|I23O1_HUMAN antibody|IDO 1 antibody|IDO antibody|IDO-1 antibody|IDO1 antibody|INDO antibody|indolamine 2,3 dioxygenase antibody|Indole 2 3 dioxygenase antibody|indoleamine 2 3 dioxygenase 1 antibody|indoleamine 2 3 dioxygenase antibody| Indoleamine 2,3-dioxygenase 1 antibody|Indoleamine pyrrole 2 3 dioxygenase antibody|Indoleamine-pyrrole 2 antibody - Gene ID
- 3620
- UniProt
- P14902
- Pathways
- Activated T Cell Proliferation
-