Did you know that you can buy products from over 140 different suppliers from us?

serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody

Details for Product No. ABIN310841
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ATSPT1, SERINE PALMITOYLTRANSFERASE 1, serine palmitoyltransferase 1, Afu6g00300, HSAN1, HSN1, LBC1, LCB1, SPT1, SPTI, wu:fc75h04, wu:fp41c08, zgc:112247, AW552086, C77762, E030036H05, Lcb1, RGD130661 ... show more
ATSPT1, SERINE PALMITOYLTRANSFERASE 1, serine palmitoyltransferase 1, Afu6g00300, HSAN1, HSN1, LBC1, LCB1, SPT1, SPTI, wu:fc75h04, wu:fp41c08, zgc:112247, AW552086, C77762, E030036H05, Lcb1, RGD1306617, Spt1 show less
Epitope
Middle Region
(25), (4), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Dog (Canine), Human, Chicken
(49), (8), (5), (1), (1), (1), (1), (1)
Host
Rabbit
(50), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(51), (27), (7), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310841
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SPTLC1
Sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHY GINIDDIDLI
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Dog : 90 %, Zebrafish : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against SPTLC1. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name SPTLC1
Background Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified.
Molecular Weight 53 kDa
Gene ID 10558
NCBI Accession NM_006415, NP_006406
UniProt O15269
Research Area Cancer, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 473 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody
anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody (2) anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody (Image 2)
anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody (3) anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody (Image 3)
Background publications McCampbell, Truong, Broom et al.: "Mutant SPTLC1 dominantly inhibits serine palmitoyltransferase activity in vivo and confers an age-dependent neuropathy." in: Human molecular genetics, Vol. 14, Issue 22, pp. 3507-21, 2005 (PubMed).

Validation Images
back to top