Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310841

serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
HSAN1, HSN1, LBC1, LCB1, SPT1, SPTI, Lcb1, Spt1, RGD1306617, wu:fc75h04, wu:fp41c08, zgc:112247, C77762, AW552086, E030036H05, ATSPT1, SERINE PALMITOYLTRANSFERASE 1, serine palmitoyltransferase 1, Afu ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310841
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1
Sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHY GINIDDIDLI
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%, Dog : 92%, Zebrafish : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against SPTLC1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SPTLC1
Background Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified.
Molecular Weight 53kDa
Gene ID 10558
NCBI Accession NP_006406, NM_006415
UniProt O15269
Research Area Cancer, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SPTLC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications McCampbell, Truong, Broom et al.: "Mutant SPTLC1 dominantly inhibits serine palmitoyltransferase activity in vivo and confers an age-dependent neuropathy." in: Human molecular genetics, Vol. 14, Issue 22, pp. 3507-21, 2005 (PubMed).

Alternatives for antigen "serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1)", type "Antibodies"
Hosts (33), (1)
Reactivities (33), (7), (3), (1), (1), (1), (1), (1)
Applications (34), (15), (6), (1), (1), (1)
Epitopes (12), (4), (2), (2), (2), (2), (1)
Beacon