SIRT5 antibody (C-Term)

Catalog No. ABIN629582

Product Details anti-SIRT5 Antibody

Target: SIRT5 (Sirtuin 5 (SIRT5))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIRT5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SIRT5 antibody was raised against the C terminal of SIRT5

Purification: Purified

Immunogen: SIRT5 antibody was raised using the C terminal of SIRT5 corresponding to a region with amino acids HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIRT5 Blocking Peptide, catalog no. 33R-3698, is also available for use as a blocking control in assays to test for specificity of this SIRT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIRT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIRT5

Target: SIRT5 (Sirtuin 5 (SIRT5))

Alternative Name: SIRT5 (SIRT5 Products)

Synonyms: SIR2L5 antibody, 0610012J09Rik antibody, 1500032M05Rik antibody, AV001953 antibody, zgc:92288 antibody, sirt5-a antibody, SIRT5 antibody, sir2l5 antibody, sirtuin 5 antibody, sirtuin 5 L homeolog antibody, SIRT5 antibody, Sirt5 antibody, sirt5 antibody, sirt5.L antibody, CC1G_00083 antibody

Background: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome